Pengkomputeran teragih - Wikipedia Bahasa Melayu, ensiklopedia bebas

ms.wikipedia.org/wiki/Pengkomputeran_teragih

Page Value

$ 0.1

Moz Rank BackLinks 0
Alexa Rank 0 Internal URL 57
Page Authority 0 External URL 11
Title Pengkomputeran teragih - Wikipedia Bahasa Melayu, ensiklopedia bebas
Description
Keywords
Domain ms.wikipedia.org
IP 208.80.154.224 2620:0:861:ed1a::1
Path /wiki/Pengkomputeran_teragih
Location United States Virginia Ashburn Wikimedia Foundation Inc. (AS14907 Wikimedia Foundation Inc.)
Page Link Analyse
Internal URL
(57)
External URL
(11)
JavaScript File
  • /w/load.php?lang=ms&modules=startup&only=scripts&raw=1&skin=vector
StyleSheet File
  • /w/load.php?lang=ms&modules=ext.uls.interlanguage%7Cext.visualEditor.desktopArticleTarget.noscript%7Cext.wikimediaBadges%7Cskins.vector.styles.legacy%7Cwikibase.client.init&only=styles&skin=vector
  • /w/load.php?lang=ms&modules=ext.gadget.charinsert-styles&only=styles&skin=vector
  • /w/load.php?lang=ms&modules=site.styles&only=styles&skin=vector
Page Text
PengkomputeranteragihDaripadaWikipedia,ensiklopediabebas.PergikenavigasiPergikecarianDalambidangsainskomputer,pengkomputeranteragihialahsatukaedahuntukmelakukansesuatutugasandenganmenggunakanberbilangkomputer.Satutugasanbesardipecahkankepadatugasan-tugasanyangkecildandilaksanakanolehkomputer-komputermikro(PCatauMac).Isikandungan1Bagaimanaiaberfungsi2Contoh-contohprojekpengkomputeranteragihyangsedangdilaksanakan3Infrastrukturbagipengkomputeranteragih4Isu–isudalampengkomputeranteragih4.1Adakahsemuatugassesuaiuntukpengkomputeranteragih?4.2Protokolkomunikasi4.3Bagaimanakomputerpenggunaakanbekerja4.4Kaedahuntukmembahagikantugasan4.5Seranganterhadappengkomputeranteragih4.6Kaedahmenghentikanparasit,pengacaudanralatolehpengguna4.7LengahBagaimanaiaberfungsi[sunting|suntingsumber]Selalunyakomputer-komputerinidihubungkandenganmnggunakaninternet.Aplikasi-aplikasiinternetmemainkanperananyangpentingdalamsistemkomputerini,terutamanyadigunakanbersamadenganbahasapengaturcaraansepertiJava.IaberfungsiapabilapenggunamemuatturunkanperisianJavadariinternetdanaturcarainiakanmemuatturunkanpula‘tugas’yangperluialaksanakandanhasilnyadiberikansemulakepadapelayanutama.Contoh-contohprojekpengkomputeranteragihyangsedangdilaksanakan[sunting|suntingsumber]AmoebadistributedoperatingsystemBerkeleyNOWProjectBerkeleyOpenInfrastructureforNetworkComputing(BOINC)(salahsatuinfrastrukturpengkomputeranteragihyangdiasaskandandibagunkanoleh[email protected]project)Climateprediction.netDistributed.net(MempunyaibanyakprojeksalahsatunyaialahmencariGolombrulersyangoptimal.SesetengahdariyangberkrjasamadgnDistributed.netialahyangtidakberasaskankeuntungan)DistributedFolding(iaberfungsisamaseperti[email protected]tetapidenganalgoritmageneticyangcubauntukmembaikikeputusansetiapmasa).FAFNER[email protected](projekUniversityofIllinoisatUrbana-Champaignuntukmenyelakukan'penglipatanprotein'(proteinfolding)GIMPS--GreatInternetMersennePrimeSearchLifemapper–CubauntukmembinataburanspesiesbiologlogiglobalMD5CRK-cubauntukmenceraikancryptographichashfunctionMD5yangselaludigunakan.Seventeenorbust–cubauntukmencarinomborperdanaberkala7untukmenyelesaikanmasalah‘Sierpinski’.Stakatininomborperdanaberkala6sudahditemui.[email protected]-SearchingforSignsofExtra-TerrestrialIntelligence(SETI).UnitedDevices–Rangkaianpengkomputeranteragihkomrsialyangterbesar.Infrastrukturbagipengkomputeranteragih[sunting|suntingsumber]COBRA-CommonObjectRequestBrokerArchitectureSOAPXML-RPCXgridICEIsu–isudalampengkomputeranteragih[sunting|suntingsumber]Adakahsemuatugassesuaiuntukpengkomputeranteragih?[sunting|suntingsumber]Pengkomputeranteragihberkerjasecarammbahagi-bahagikantugasyangbesarkepadatugas-tugasyangkecildaniaakandiagih-agihkankepadamikrokomputeryanglainuntukdilaksanakan.Jikatugastersebuttidakbolehdipecahkankepadatugasyangkecilmakapengkomputeranteragihtidaksesuaiuntuktugasantersebut.Contohtugasanyangtidakbolehdipecahkankepadatugasanyangkecilialahsatutugasanyangmestidilakukansecaralineardaniamestidilaksanakansecarabersiri,keputusanyangsebelumdiperlukanuntukmelaksanakantugasanyangakandatang.Kerja-kerjayangmelibatkankerahsiaanyangtinggijugatidaksesuaiuntukdilaksanakanmenggunakankaedahpengkomputeranini.Contoh-contohyangmemerlukankerahsiaanyangtinggiialahpenyelidikanmengenaiketenteraan,merekaciptasenjatatermaju,penyelidikanmegenaiteknologinuklearpemusnahatauyangmelibatkanpatenthakcipta.Protokolkomunikasi[sunting|suntingsumber]Untukmerealisasikanpengkomputeranteragih,sistemuntukkomputerutamamengagihkankerja-kerjadanmendapatkansemulahasilnyadaripenggunaadalahpenting.Emaildanhttptelahmenjadimekanismakomunikasiyangdigunakansecarameluas.Pilihanbergantungkepadasumberyangada.Jikasesebuahkomputerhanyaberadaditalian(online)hanyasejamsehari,makakaedahemailadalahyangpalingsesuai.Masalahyangterdapatdisiniialahapabilakomputerpenggunahendakmembukaemaildankitamestiingatbahawatidaksemuapenggunamenggunakanpembacaemailyangsama,jugapenggunatidakakansukajikaterdapatemailyangterlalubanyakdalampetimelmereka.Jikakomputerutamamempunyaipelayanyangsentiasaberadaditalianmakakaedahpelayanweb(webserver).PenggunabolehmembuatpermintaanhttpkepadaURLdanpelayanakanmeberikanpakejkerjakepadapengguna.Protokollainadalahkurangpraktikal.Bagaimanakomputerpenggunaakanbekerja[sunting|suntingsumber]Pengkomputeranteragihberkonsepkanbahawapenggunabolehterusmenggunakankomputermerekatanpameyedaribahawakomputermerekasedangmelakukantugasanlain.Terdapatduakeadahbiasayangdigunakaniaitumenjalankanrutinmelahu(idle)ataumenulissatupenyelamatskrin(screensaver).Tugasanmelahuhanyaakandilakukanapabilakomputertidakmelakukanapa-apa(yelah,dahnamapunmelahu).Penjadualanmelahuakandirekauntukbekerjapadamasaini.Jikapenggunamenggerakantetikusmakatugasantersebutakanmenghentikanaktivitinyadanmenungguuntukmelaksanakanapayangpenggunamahu.Sistempengoperasianmodendapatmelakukanrutininidengansangatbaik.Kaedahlainyangpopularialahdenganmemaparkanpenyelamatskrin.Iamudahditulisdaniasenanguntukdifahamiolehorangyangbukandalambidangteknikal.Penggunabiasaakanmemahamibahawapenyelamatskrinhanyaakanberfungsiapabilamerekakeluarmakandaniatidakakanmenganggutugasyangsedangdilakukan.ProjekSETImelakukaniadengansangatbaik,semasaiasedangmelakukanoperasipadakomputerpengguna,iaakanmemaparkangrafik-grafikyangmenarikdanmemaparkanpengiraanyangsedangdijalankan,iniakanmembuatkanpenggunabiasateruja.Penjadualanmodenmelakukantugasnyadengansangatsempurna.Penggunatidakakansedarbahawakomputermerekasedangbekerjadibelakangdaniajikadibandingkandengankaedahpenyelamatskrinadalahjauhlebihbaik.Penyelamatskrinjugaakanmenyebabkanpenggunabiasayangtidakmemahamibidangteknikalberasatakutbahawakomputermerekaakancepatrosakkeranasentiasamelakukantugastanparehat.Kaedahuntukmembahagikantugasan[sunting|suntingsumber]Terdapatberbagai-bagaikaedah,kitaambilcontohkesdistributed.net.Kekunciyangbermuladarikosongke264daniaakandipecahkankepada228.Bilapenggunamemintasesuatukerja,pelayanakanmemberikansatusettugasyangmempunyai10blok.Kenapa228?Jawapanyamudah,blok232akanmemakanmasaterlalulamauntukdilaksanakandan224akanmemakanmasaterlalucepat.Seranganterhadappengkomputeranteragih[sunting|suntingsumber]Terdapattigajenisseranganyangtelahdikenalpastiiaituparasit,pengacaudankerosakanpadakomputerpengguna.Pihakyangmenjalankanpengkomputeranteragihmungkinakanmemberikansatubentukpenghargaansepertikewangandansebagainya.Padamasaini,orangramaiyanginginmembantudalamprojekpengkomputeranteragihadalahkeranamerekainginmembantu.Tetapidimasadepanapabilakitadapatmelihatbayarandalambentuktunaikepadapengguna,iniakanmengakibatkanramaioranguntukmelibatkandiridalamsesuatuprojek.Paraparasitiniakancubauntukmedapatkanganjarantanpamelakukankerja.Sepertijugadenganparasityangmahumendapatkanganjarantanpamelakukansebarangtugas,terdapatjugamerekayangmahumengagalkansesuatuprojek.Inidikenalisebagaipengacau.Kerosakanpadakomputerpenggunasebenarnyabukanlahsatubentukserangantetapisatubentukganguanpadasystem.Jikaaturcarauntukmelaksanakansatupengkomputeranteragihtelahditulisdengansempurna,tetapiperkakasanpadapenggunamengalamimasalahiaakanmeyebabkanralatdalampengiraan.Pihakpenyediapengkomputeranteragihinisepatutnyameyediakanmekanismadalamanuntukmenyemaksemuladatayangtelahdihantaruntukmemastikaniabebasralat.Kaedahmenghentikanparasit,pengacaudanralatolehpengguna[sunting|suntingsumber]Carayangpalingmudahialahdenganmengulangkerjasecararawak.Saturutinuntukmenghantarsatutugasyangsamadanmeyemaksamaadaiamemberikanhasilyangsamaatautidak.Masalahnyaialahapabilaterdapatpenggunayangbernar-benaraslihendakmembantu,iatentunyaakanmerugikanmasadansumber.Ganjaranhanyadiberikankepadatugasyangberjaya.Denganmegabaikanorangyangkurangbernasibbaikyangmendapatpakejkerjayangtidakmeyumbangkepadakejayaansesuatuprojekakanmengurangkanserangan.Jugadengantidakmemberisebarangganjaranmakamotivasiparapenyerangakanmerudumdenganpantas.tetapikaedahiniakanmenggurangkanorangyanginginmeyumbangkankuasapengkomputeranmeraka.Satulagikaedahuntukmenanganiperasitdanpengacauialahdenganmengabaikanhasilyangdidapatidengan‘luarbiasapantas’.Sedangkankomputeryangpalingmodenjugamempunyaiketerbatasanyangtertentu,adalahtidakmasukakalbagisesebuahkomputeryangdapatmengeluarkanhasildengansertamerta.Selalunyaparasit-parasitiniakancubauntukmedapatkansebanyakmungkintugasuntukdilaksanakansupayaganjaranyangmerekaperolehilebihtinggi.Jadidengancarainiiasekurang-kurangnyadapatmeminimumkanserangan.Caralainuntukmeminimumkanseranganialahdengantidakmenyebarkankodsumber(sourcecode).Kodyangtelahdikompiladalahsangatsukaruntukuntukdi‘reverseengineer’kan.Walaupunparasit-parasitiniakandapatjugamenterbalikanyanamundenganaturcarayangtelahdikompil,prosesinimejadilebihsukar.Jikakomputerpelanggantersebuttelahdi‘reverseengineer’kaniatidakmenjadimasalahkeranakitabolehmenyebarkanversikeduadanparasit-parasitdanpengacauiniterpaksamelakukankerjamerekadarimuladanakhirnyamerekaakanmanjadijemu.Lengah[sunting|suntingsumber]Tidaksemuapenggunamempunyaitalianinternetyanglajusepertibroadband.Taliandial-upyanglambatakanmeyebabkanlengahdalammenghantarpakejdanmenerimahasilnyasemula.<imgsrc="//ms.wikipedia.org/wiki/Special:CentralAutoLogin/start?type=1x1"alt=""title=""width="1"height="1"style="border:none;position:absolute;"/>Diambildaripada"https://ms.wikipedia.org/w/index.php?title=Pengkomputeran_teragih&oldid=2782794"Kategori:PengkomputeranMenupanduarahAlatperibadiBelumlogmasukPerbincanganSumbanganBukaakaunLogmasukRuangnamaRencanaPerbincanganKelainanexpandedcollapsedRupaBacaSuntingSuntingsumberLihatsejarahLagiexpandedcollapsedCariPanduarahLamanUtamaTinjauHalsemasaRencanarawakPerhubunganTentangWikipediaPortalmasyarakatPerubahanterkiniHubungikamiMendermaBantuanKedaiKopiPeralatanPautankelamaniniPerubahanberkaitanMuatnaikfailLamankhasPautankekalMaklumatlamanPetiklamaniniButirWikidataCetak/eksportCiptabukuMuatturunsebagaiPDFVersibolehcetakDalamprojeklainWikimediaCommonsDalambahasalainالعربيةBahasaIndonesiaБеларускаяБеларуская(тарашкевіца)BosanskiБългарскиCatalàČeštinaDanskDeutschEestiΕλληνικάEnglishEspañolEsperantoEuskaraفارسیFrançais한국어IdoItalianoעבריתქართულიҚазақшаLatviešuLietuviųMagyarМакедонскиമലയാളംМонголNederlands日本語NorskbokmålNorsknynorskPolskiPortuguêsRomânăРусскийSimpleEnglishSlovenčinaСрпски/srpskiSuomiSvenskaதமிழ்TiếngViệtTürkçeУкраїнськаاردو粵語中文SuntingpautanLamaninikaliterakhirdisuntingpada13:11,8Mac2013.TeksdisediakandenganLesenCreativeCommonsPengiktirafan/PerkongsianSerupa;termatambahanmungkindigunakan.LihatTermaPenggunaanuntukbutiranlanjut.DasarprivasiPerihalWikipediaPenafianPaparanmudahalihPembangunStatistikKenyataankuki
ms.wikipedia.org - Pages
Hot Host
Quickly calculate the estimated worth of your page and build reports as table.Youtube Video Analyticssitemap