Sodàna - Wikipedia

mg.wikipedia.org/wiki/Sod%C3%A0na

Page Value

$ 0.1

Moz Rank BackLinks 0
Alexa Rank 0 Internal URL 309
Page Authority 0 External URL 10
Title Sodàna - Wikipedia
Description
Keywords
Domain mg.wikipedia.org
IP 208.80.154.224 2620:0:861:ed1a::1
Path /wiki/Sodàna
Location United States Virginia Ashburn Wikimedia Foundation Inc. (AS14907 Wikimedia Foundation Inc.)
Page Link Analyse
Internal URL
(309)
External URL
(10)
JavaScript File
  • /w/load.php?lang=mg&modules=startup&only=scripts&raw=1&skin=vector
StyleSheet File
  • /w/load.php?lang=mg&modules=ext.uls.interlanguage%7Cext.visualEditor.desktopArticleTarget.noscript%7Cext.wikimediaBadges%7Cskins.vector.styles.legacy%7Cwikibase.client.init&only=styles&skin=vector
  • /w/load.php?lang=mg&modules=site.styles&only=styles&skin=vector
Page Text
SodànaAvyamin'iWikipediaAlleràlanavigationAlleràlarechercheSainam-pirenen'iSodànaMari-piandrianan'iSodànaISodànaeoanivon'iAfrikaSarin-tanin'iSodànaISodànanaRepoblikan'iSodànadiafirenenaaoAfrikaAtsinanana,izaymananamorontsirakaaoamin'nyRanomasinaMenaavyaoavaratra-atsinananaizysadymamakivakyazyavyanyavaratramianatsimonylohasahasynyonin'iNily.Mananavelaran-tanymirefy1 886 068 km²iSodàna.IKhartoumnorenivohiny.MamaritraazyavyaoavaratraiEjipta,aoatsinananaiEritrea,aoatsimoiKeniasyiOgandaarynyRepoblikaDemôkratikan'iKôngô,aryaoandrefananyRepoblikan'iAfrikaAfovoanysyiTsadyaryiLibia.Firenenaanjakan'nytanyefitraiSodàna,kazava-dehibeindrindraaminynyrano:nyonyNilynomahalonakaan'ireolohasahamaro.Nyampahanybeamin'nytanin'iSodànadoatondrahan'nyonin'iNily.Aoavaratra,andaninysyankilan'iNily,diaahitananytanyefitr'iLibia(ilanyandrefana),izayzarazarain'nylembalembamaro,synytanyefitr'iNobia(ilanyatsinanana),izayfefen'nytandavan-tendrombohitraamin'nymorontsirakaaoamin'nyRanomasinaMena.Aoafovoan-tanynoahitanaan'iSahelyizayvakivakin'iNilyFotsysyiNilyMangaaryiAtbara.Aoandrefananoahitanaan'iDarfour,izayfaritrabetendrombohitrasyahitanalembalembakarankaina.MiovaovaarakarakanyfaritranytoetanyaoSodàna:toetanykarankainaan-tanyefitranyaoavaratra,toetanin-jana-pehin-tanynyaoafovoanyarytoetanim-pehiben-tanybeorananyatsimo.Mizarahovondronalehiberoalehibenyvahoakasodaney,diaireovahoakamanarakanyfinoanasilamo(75 %)izaymoninaaoavaratrasyaoafovoan-tany,syireovahoakakristianasympanarakanyfivavahan-drazanaafrikanaaoatsimo.Miompanaamin'nyfambolenanytoekaren’iSodàna.Izynofirenenavoalohanympamokatranygômaaraboizayampiasainaamin'nyfitehirizanavoankazomamynahandroinanaamin'nyfanamboaranaranomanitra.Simban'nyadyan-tranoanefaizanytoekarenaizanynanombokaamin'nynafazoanynyfahaleovan-tenatamin'nytaona1956.Nyfitenyarabonofitenyôfisialin'iSodàna.Jereokoa[hanova|hanovanyfango]FirenenaaoAfrika:AfrikaAtsimo-Alzeria-Angôla-Benino-BorkinaFasô-Borondy-Bôtsoana-Ejipta-Eritrea-Esoatiny(Soazilandytaloha)-Etiôpia-Gabôna-Gambia-Ganà-Ginea-GineaBisao-GineaEkoatôrialy-Jibotỳ-Kamerona-Kapvera-Kenia-Kômôro-Kôtidivoara-Lezôtô-Liberia-Libia-Madagasikara-Malaoy-Malỳ-Maorisy-Maoritania-Marôka-Môzambika-Namibia-Nizera-Nizeria-Oganda-RepoblikaAraboSaharaoyDemôkratika-RepoblikaDemôkratikan'iKôngô-Repoblikan'iAfrikaAfovoany-Repoblikan'iKôngô-Roanda-SaôTômeePrinsipe-Seisely-Senegaly-SieraLeôna-Sodàna-SodànaAtsimo-Sômalia-Sômalilandy-Tanzania-Tôgô-Tonizia-Tsady-Zambia-Zimbaboe<imgsrc="//mg.wikipedia.org/wiki/Special:CentralAutoLogin/start?type=1x1"alt=""title=""width="1"height="1"style="border:none;position:absolute;"/>Hitataoamin'ny"https://mg.wikipedia.org/w/index.php?title=Sodàna&oldid=1012530"Sokajy :FirenenaaoAfrikaFirenenaSodanaMenyfitetezanaFitaovanamanokanaTsytafiditraPejin-dresakaFandraisan'anjaraHamoronakaontyHiditraValam-pejyLahatsoratradinikaNy''skin''VoasintonadéveloppérepliéFijerenaHamakyHanovaHanovanyfangoHijerynytantaraMisimisykokoadéveloppérepliéTadiavoFikarohanaFandraisanaWikipediafindayPejyrehetraPejyvaovaoTakelakakisendraFikambananaToeranairaisanaToeranaiombonanaNon-malagasyspeakersHandrayanjaraFampidiranaFiovanafaranyNyvaovaoHandefatakelakaFanomezanaKianjam-pasikaFanoroanasyfitsipikaRenipejyFototradimyFanamboaranatakelakaFitaovanaPejymirohyetoNovainaHandefarakitraPejymanokanaRohymaharitraFampahalalanamikasikanypejyHitanisaitypejyityZavatraWikidataPrintiana/avoakaHanorinabokyHampidinahotoaPDFNyvotoatinyazoatontaprintyAmin'nytetikasahafaWikimediaCommonsAmin'nytenim-pirenenahafaAcèhАдыгабзэAfrikaansAkanAlemannischአማርኛAragonésÆngliscالعربيةܐܪܡܝܐالدارجةمصرىAsturianuKotavaAymararuAzərbaycancaتۆرکجهБашҡортсаBasaBaliBoarischŽemaitėškaBikolCentralБеларускаяБеларуская(тарашкевіца)БългарскиभोजपुरीBanjarBamanankanবাংলাབོད་ཡིགবিষ্ণুপ্রিয়ামণিপুরীBrezhonegBosanskiБуряадCatalàChavacanodeZamboangaMìng-dĕ̤ng-ngṳ̄НохчийнCebuanoکوردیCorsuQırımtatarcaČeštinaЧӑвашлаCymraegDanskDagbanliDeutschThuɔŋjäŋZazakiDolnoserbskiडोटेलीދިވެހިބަސްEʋegbeΕλληνικάEnglishEsperantoEspañolEestiEuskaraEstremeñuفارسیFulfuldeSuomiVõroFøroysktFrançaisArpetanNordfriiskFryskGaeilgeGagauzKriyòlgwiyannenGàidhligGalegoAvañe'ẽगोंयचीकोंकणी/GõychiKonknniગુજરાતીGaelgHausa客家語/Hak-kâ-ngîעבריתहिन्दीFijiHindiHrvatskiHornjoserbsceKreyòlayisyenMagyarՀայերենԱրեւմտահայերէնInterlinguaBahasaIndonesiaInterlingueIgboIlokanoГӀалгӀайIdoÍslenskaItaliano日本語PatoisLa.lojban.JawaქართულიQaraqalpaqshaTaqbaylitАдыгэбзэKabɩyɛKongoGĩkũyũҚазақшаಕನ್ನಡ한국어KurdîKernowekКыргызчаLatinaLëtzebuergeschЛезгиLinguaFrancaNovaLugandaLimburgsLigureLadinLombardLingálaLietuviųLatviešuМакедонскиമലയാളംМонголमराठीКырыкмарыBahasaMelayuMaltiမြန်မာဘာသာЭрзяньمازِرونیDorerinNaoeroNāhuatlPlattdüütschNedersaksiesनेपालीनेपालभाषाNederlandsNorsknynorskNorskbokmålNovialSesothosaLeboaDinébizaadChi-ChewaOccitanLivvinkarjalaOromooИронਪੰਜਾਬੀKapampanganPapiamentuDeitschपालिNorfuk/PitkernPolskiPiemontèisپنجابیپښتوPortuguêsRunaSimiRumantschRomânăTarandíneРусскийРусиньскыйIkinyarwandaसंस्कृतम्СахатылаᱥᱟᱱᱛᱟᱲᱤSarduSicilianuScotsسنڌيDavvisámegiellaSängöSrpskohrvatski/српскохрватскиၽႃႇသႃႇတႆးSimpleEnglishSlovenčinaSlovenščinaGaganaSamoaAnarâškielâChiShonaSoomaaligaShqipСрпски/srpskiSiSwatiSesothoSeelterskSundaSvenskaKiswahiliŚlůnskiSakizayaதமிழ்తెలుగుТоҷикӣไทยትግርኛTürkmençeTagalogTürkçeXitsongaТатарча/tatarçaУдмуртئۇيغۇرچە/UyghurcheУкраїнськаاردوOʻzbekcha/ўзбекчаVènetoVepsänkel’TiếngViệtVolapükWinarayWolof吴语ХальмгმარგალურიייִדישYorùbáVahcuenghZeêuws中文文言Bân-lâm-gú粵語IsiZuluHanovanyrohyVoaovafaranytamin'ny28Jiona2021amin'ny13:10itypejyity.AzoampiasainaarakanyfepetraapetrakynylisansaCreativeCommonsAttribution-ShareAlike;Metymisynyfepetrafanampinymihatra.Jereofepetram-pampiasanahoan'nyantsipirihany.Fitsipikamombanyzavatratsysarababem-bahoakaMombamombanyWikipediaFampitandremanaJeryam-pindayMpanitatraStatistiquesDéclarationsurlestémoins(cookies)
mg.wikipedia.org - Pages
Hot Host
Quickly calculate the estimated worth of your page and build reports as table.Youtube Video Analyticssitemap