Meld u aan bij uw Adobe-account met uw Facebook-, Google- of Apple-account.

helpx.adobe.com/nl/x-productkb/global/adobe-id-social-sign-in.html

Page Value

$ 0.1

Moz Rank 7 BackLinks -1
Alexa Rank -1 Internal URL 69
Page Authority 70 External URL 0
Title Meld u aan bij uw Adobe-account met uw Facebook-, Google- of Apple-account.
Description Kom te weten hoe u uw sociale account (Facebook, Google of Apple) kunt gebruiken om een Adobe-account aan te maken. Leer ook hoe u uw sociale account aan uw bestaande Adobe-account kunt koppelen.
Keywords MAX2019 AllApps
Domain helpx.adobe.com
IP 104.123.154.168 104.123.154.139 2600:1406:6c00::17cc:911b 2600:1406:6c00::17cc:913b
Path /nl/x-productkb/global/adobe-id-social-sign-in.html
Location United States California San Jose Akamai International B.V. (AS20940 Akamai International B.V.)
Page Link Analyse
Internal URL
(69)
External URL
(0)
JavaScript File
  • /etc.dexter.dexterlibs/dexter/clientlibs/base/headIE.fp-8bbe9a4eee8062afe68ae276ac39e4ed.js
  • /etc.dexter.dexterlibs/dexter/clientlibs/base/head.fp-708e64f3024b3872af42b32eadb26e05.js
StyleSheet File
  • https://use.typekit.net/glm4yoq.css
  • /etc.dexter.dexterlibs/helpx/clientBundles/main/clientlibs.fp-51619fc8402e1710f3092a8f3420db4f.css
  • /etc.dexter.dexterlibs/helpx/clientBundles/article3Components/clientlibs.fp-a4034ed8ee001f6a038f663f1db33dbc.css
Page Text
AanmeldenmetuwsocialeaccountZoekenLaatstbijgewerktop2021-07-30Komtewetenhoeuuwsocialeaccount(Facebook,GoogleofApple)kuntgebruikenomeenAdobe-accountaantemaken.LeerookhoeuuwsocialeaccountaanuwbestaandeAdobe-accountkuntkoppelen.Hebtueenwerk-ofschoolaccountgekoppeldaanGoogle?UbentviadataccountaangemeldbijAdobe.Ukuntzichveiligaanmeldenmeteentikinplaatsvaneenwachtwoordintevoeren.DownloadgewoondeAdobeAccountAccess-app(iOS|Android)envolgdeinstructies. UwsocialeaccountgebruikenomuwAdobe-accounttemakenUkuntuwFacebook-,Google-ofApple-accountgebruikenomeenAdobe-accountaantemaken.Alsuzichvoorheteerstaanmeldtmetuwsocialeaccount,wordtuwAdobe-accountaangemaakt.DaarnakuntuzicheenvoudigaanmeldenmetuwsocialeaccountenzouwAdobe-accountbeheren.VolgonderstaandestappenomuwAdobe-accountaantemaken:Ganaar https://account.adobe.com.KiesFacebook,GoogleofAppleophetaanmeldingsscherm.VoerdegegevensvanuwFacebook-,Google-ofApple-accountinenvolgdeinstructiesophetscherm.UwAdobe-accountisingesteld. Opmerking:Alsuzichmetuwtelefoonnummerbijuwsocialeaccounthebtaangemeld,wordtugevraagdomeene-mailadresoptegeven.Ditwordtdanhete-mailadresdataanuwAdobeIDisgekoppeld.UwsocialeaccountkoppelenaanuwbestaandeAdobe-accountErzijntweemanierenomuwFacebook-,Google-ofApple-accountaanuwbestaandeAdobe-accounttekoppelen:Alsdee-mail-IDvanuwsocialeaccounthetzelfdeisalsuwAdobeIDAlsdee-mail-IDvanuwsocialeaccountverschiltvanuwAdobeIDE-mail-IDvanuwsocialeaccountishetzelfdealsuwAdobeIDGanaarhttps://account.adobe.com/nl.SelecteerFacebook,GoogleofAppleophetaanmeldingsscherm.VoerdegegevensvanuwFacebook-,Google-ofApple-accountin.SelecteerMijnaccountskoppelenomuwFacebook-,Google-ofApple-accounttekoppelenaanuwbestaandeAdobe-account.Erwordteenverificatiecodenaarhete-mailadresvanuwAdobeIDverzonden.VoerdeverificatiecodeinhetvolgendevensterinenselecteervervolgensVerifiëren. Selecteer Gereed. UwAdobe-accountisnuaanuwsocialeaccountgekoppeld.UkuntzichnueenvoudigaanmeldenmetuwsocialeaccountomuwAdobe-accounttebeheren.Ukuntzichooknog,zoalsvoorheen,aanmeldenmetuwAdobeID.Dee-mail-IDvanuwsocialeaccountverschiltvanuwhete-mailadresvanuwAdobe-accountMelduaanop https://account.adobe.com/nl/security.SelecteerinhetgedeeltevooraanmeldenviasocialmediaKoppelennaastFacebook,GoogleofApple.Volgdeinstructiesophetscherm.UwsocialeaccountisnuaanuwAdobe-accountgekoppeld.UkuntzichnueenvoudigaanmeldenmetuwsocialeaccountomuwAdobe-accounttebeheren.Ukuntzichooknog,zoalsvoorheen,aanmeldenmetuwAdobeID.Opmerking:Alsueengedeeldecomputergebruikt,moetuzichookafmeldenbijFacebook,GoogleofApplewanneeruzichafmeldtbijAdobe-appsofeenwebpaginavanAdobe.UwFacebook-,Google-ofApple-accountvanuwAdobe-accountloskoppelenGaalsvolgttewerkomuwFacebook-,Google-ofApple-accountvanuwAdobe-accountlostekoppelen:Melduaanop https://account.adobe.com/nl/security.SelecteerinhetgedeeltevooraanmeldenviasocialmediaOntkoppelennaastFacebook,GoogleofApple.KiesOntkoppelenindemeldingdieverschijnt.Opmerking:Alsunognooiteenwachtwoordvooruwaccounthebtingesteld,wordtugevraagdeenwachtwoordaantemakenalsuprobeerthetsocialeaccountdatuhetlaatsthebtgekoppeldteverwijderen.ProbleemoplossingvoorfoutenbijaanmeldingviasocialemediaLeesvoormeerinformatieoverhetoplossenvanproblemenmetbetrekkingtotaanmeldingviasocialeaccounts,hetartikelProblemenoplossendiekunnenoptredenwanneeruzichbijuwAdobe-accountaanmeldtmetFacebook,GoogleofApple.VerwanteinformatieMelduaanbijuwAdobe-accountAanmeldingsfoutenmetuwsocialeaccountoplossenProblemenmetAdobeIDenaanmeldingoplossenAanmeldenbijjeaccountAanmeldenAccountbeherenSnellekoppelingenAlleuwlidmaatschappenweergevenJelidmaatschappenbeherenJuridischekennisgeving   |   OnlineprivacybeleidVraaghetdecommunityVragenstellenenantwoordkrijgenvanexperts.NuvragenContactmetonsopnemenEchtehulpvanechtemensen.Nustarten^ NaarbovenLanguageNavigationLanguageNavigationKiesjeregioAlseenregiowordtgeselecteerd,wordtdetaalen/ofdecontentgewijzigdopAdobe.com.AmericasBrasilCanada-EnglishCanada-FrançaisLatinoaméricaMéxicoUnitedStatesAsiaPacificAustraliaHongKongS.A.R.ofChinaIndia-EnglishNewZealandSoutheastAsia(IncludesIndonesia,Malaysia,Philippines,Singapore,Thailand,andVietnam)-English中国中國香港特別行政區台灣地區日本한국Europe,MiddleEastandAfricaAfrica-EnglishBelgië-NederlandsBelgique-FrançaisBelgium-EnglishČeskárepublikaCyprus-EnglishDanmarkDeutschlandEestiEspañaFranceGreece-EnglishIrelandIsrael-EnglishItaliaLatvijaLietuvaLuxembourg-DeutschLuxembourg-EnglishLuxembourg-FrançaisMagyarországMalta-EnglishMiddleEastandNorthAfrica-EnglishNederlandNorgeÖsterreichPolskaPortugalRomâniaSchweizSlovenijaSlovenskoSuisseSuomiSvizzeraTürkiyeUnitedKingdomБългарияРоссияУкраїнаالشرقالأوسطوشمالأفريقيا-اللغةالعربيةישראל-עבריתSverige
helpx.adobe.com - Pages
Hot Host
Quickly calculate the estimated worth of your page and build reports as table.Youtube Video Analyticssitemap